PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G0455
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 295aa    MW: 32328.2 Da    PI: 8.0172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G0455genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.93.1e-10653345
                     SS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwq 45
                     +W+ eE++ + +a++++  +      +W++Ia+t++ +++l+++k+++ 
      Gh_A09G0455  6 SWSREEEKAFENAIAMHWIDkeeceeQWEKIASTVP-TKSLEELKLHYE 53
                     7*****************99****************.**********96 PP

2Myb_DNA-binding391.9e-12133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
      Gh_A09G0455 133 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 177
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.139260IPR017884SANT domain
SMARTSM007170.0013358IPR001005SANT/Myb domain
SuperFamilySSF466894.09E-8662IPR009057Homeodomain-like
CDDcd001678.95E-7656No hitNo description
PfamPF002496.7E-6653IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-4653IPR009057Homeodomain-like
PROSITE profilePS5129417.282125182IPR017930Myb domain
SuperFamilySSF466897.18E-17128183IPR009057Homeodomain-like
SMARTSM007172.3E-10130180IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.1E-17130180IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.3E-11131176IPR009057Homeodomain-like
CDDcd001679.64E-10133178No hitNo description
PfamPF002497.2E-11133177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAGSVSWSRE EEKAFENAIA MHWIDKEECE EQWEKIASTV PTKSLEELKL HYELLVEDVT  60
AIEAGHVPLP RYKGEEPSSS AKDHFHGPSM APNSDRRSNS GYGNGFSGLT LDSTGHGGKQ  120
SSRSDQERRK GIPWTEEEHR LFLLGLDKFG KGDWRSISRN FVISRTPTQV ASHAQKYFIR  180
LNSMNRDRRR SSIHDITSVN NGDTSHQAPI TGQQANTNSP GAAVMGQSVK HRAHPHLPGL  240
GMYGAPVGRP IAAAPGHIGS AAGTPVMLPP AHHPHSPPPY IVPVAYPMAP PPMHQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012484322.10.0PREDICTED: transcription factor DIVARICATA
TrEMBLA0A0B0MV820.0A0A0B0MV82_G
STRINGPOPTR_0012s05720.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM103042535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.12e-81MYB family protein